The domain within your query sequence starts at position 8 and ends at position 544; the E-value for the MCLC domain shown below is < 1e-12.

CRLLLCECLLLITGYAHDDDWIDPTDMLNYDAASGTMRKSQVRSGTSEKKEVSPDSSEAE
ELSDCLHRLDSLTHKVDSCEKKKMKDYESQSNPVFRRYLNKILIEAGKLGLPDENKVEMR
YDAEILLSRQTLLEIQKFLSGEEWKPGALDDALSDILINFKCHDSEAWKWQFEDYFGVDP
YNVFMVLLCLLCLVVLVATELWTYVRWYTQMKRIFIISFLLSLAWNWIYLYKMAFAQHQA
NIAGMEPFDNLCAKKMDWTGSLWEWFTSSWTYKDDPCQKYYELLIVNPIWLVPPTKALAI
TFTNFVTEPLKHIGKGAGEFIKALMKEIPVLLQIPVLAILALAVLSFCYGAGRSVPMLRH
FGGPDREPPRALEPDDRRRQKGLDYRLHGGAGDADFSYRGPAGSIEQGPYDKMHASKRDA
LRQRFHSGNKSPEVLRAFDLPDTEAQEHPEVVPSHKSPIMNTNLETGELPGESTPTEYSQ
SAKDVSGQVPSAGKSSPTVDKAQLKTDSECSPPGGCPPSKEAAVAAHGTEPVSSPCG

MCLC

MCLC
PFAM accession number:PF05934
Interpro abstract (IPR009231):

This entry consists of several Chloride channel CLIC-like proteins, which function as a chloride channel when incorporated in the planar lipid bilayer [(PUBMED:11279057)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MCLC