The domain within your query sequence starts at position 503 and ends at position 623; the E-value for the MCM domain shown below is 1.4e-9.

EASPCHPLLPTVQHTLKKAVEPEGLLYLASKQFTTEDFEKLLAFAKSLNMEFSLEAERMI
HGYYLASRRIRTDSIHGSKLSASALKYLVSLSEAHARLSLRTTVLREDALIAALLLEISL
T

MCM

 MCM
PFAM accession number:PF00493
Interpro abstract (IPR001208):

Proteins shown to be required for the initiation of eukaryotic DNA replication share a highly conserved domain of about 210 amino-acid residues [ (PUBMED:1454522) (PUBMED:8265339) (PUBMED:14731643) ]. The latter shows some similarities [ (PUBMED:8332451) ] with that of various other families of DNA-dependent ATPases. Eukaryotes seem to possess a family of eight proteins that contain this domain. They were first identified in yeast where most of them have a direct role in the initiation of chromosomal DNA replication by interacting directly with autonomously replicating sequences (ARS). They were thus called 'minichromosome maintenance proteins' with gene symbols prefixed by MCM. These six proteins are:

  • MCM2, also known as cdc19 (in S.pombe).
  • MCM3, also known as DNA polymerase alpha holoenzyme-associated protein P1, RLF beta subunit or ROA.
  • MCM4, also known as CDC54, cdc21 (in S.pombe) or dpa (in Drosophila).
  • MCM5, also known as CDC46 or nda4 (in S.pombe).
  • MCM6, also known as mis5 (in S.pombe).
  • MCM7, also known as CDC47 or Prolifera (in A.thaliana).
  • MCM8, also known as as REC (in Drosophila).
  • MCM

These proteins are evolutionarily related and belong to the AAA+ superfamily. They contain the Mcm family domain, which includes motifs that are required for ATP hydrolysis (such as the Walker A and B, and R-finger motifs). Mcm2-7 forms a hexameric complex which is the replicative helicase involved in replication initiation and elongation, whereas Mcm8 and Mcm9 from and separate one, conserved among many eukaryotes except yeast and C. elegans. Mcm8/9 complex play a role during replication elongation or recombination, being involved in the repair of double-stranded DNA breaks and DNA interstrand cross-links by homologous recombination. Drosophila is the only organism that has MCM8 without MCM9, involved in meiotic recombination [ (PUBMED:22771115) (PUBMED:30743181) ].

GO process:DNA duplex unwinding (GO:0032508)
GO function:DNA binding (GO:0003677), ATP binding (GO:0005524)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MCM