The domain within your query sequence starts at position 1 and ends at position 58; the E-value for the MCM_N domain shown below is 5.3e-10.

MMEQRSRDPGAVRNPQNQYPSELMRRFELYFRGPSSSKPRVIREVRADSVGKLLTVRG

MCM_N

MCM_N
PFAM accession number:PF14551
Interpro abstract (IPR027925):

This entry represents the N-terminal region of MCM proteins. This region is composed of three structural domains. Firstly a four helical bundle, secondly a zinc binding motif and thirdly an OB-like fold [(PUBMED:12548282)].

MCM proteins are DNA-dependent ATPases required for the initiation of eukaryotic DNA replication [(PUBMED:1454522), (PUBMED:8265339), (PUBMED:14731643)]. In eukaryotes there is a family of six proteins, MCM2 to MCM7. They were first identified in yeast where most of them have a direct role in the initiation of chromosomal DNA replication by interacting directly with autonomously replicating sequences (ARS). They were thus called minichromosome maintenance proteins, MCM proteins [(PUBMED:8332451)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MCM_N