SMART: Pfam domain MCM

The domain within your query sequence starts at position 1 and ends at position 58; the E-value for the MCM_N domain shown below is 9.5e-10.

MMEQRSRDPGAVRNPQNQYPSELMRRFELYFRGPSSSKPRVIREVRADSVGKLLTVRG

MCM_N

PFAM accession number:	PF14551
Interpro abstract (IPR027925):	This entry represents the N-terminal region of MCM proteins. This region is composed of three structural domains. Firstly a four helical bundle, secondly a zinc binding motif and thirdly an OB-like fold [ (PUBMED:12548282) ]. MCM proteins are DNA-dependent ATPases required for the initiation of eukaryotic DNA replication [ (PUBMED:1454522) (PUBMED:8265339) (PUBMED:14731643) ]. In eukaryotes there is a family of six proteins, MCM2 to MCM7. They were first identified in yeast where most of them have a direct role in the initiation of chromosomal DNA replication by interacting directly with autonomously replicating sequences (ARS). They were thus called minichromosome maintenance proteins, MCM proteins [ (PUBMED:8332451) ].

PFAM accession number:

PF14551

Interpro abstract (IPR027925):

This entry represents the N-terminal region of MCM proteins. This region is composed of three structural domains. Firstly a four helical bundle, secondly a zinc binding motif and thirdly an OB-like fold [ (PUBMED:12548282) ].

MCM proteins are DNA-dependent ATPases required for the initiation of eukaryotic DNA replication [ (PUBMED:1454522) (PUBMED:8265339) (PUBMED:14731643) ]. In eukaryotes there is a family of six proteins, MCM2 to MCM7. They were first identified in yeast where most of them have a direct role in the initiation of chromosomal DNA replication by interacting directly with autonomously replicating sequences (ARS). They were thus called minichromosome maintenance proteins, MCM proteins [ (PUBMED:8332451) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MCM_N