The domain within your query sequence starts at position 37 and ends at position 166; the E-value for the MCM_bind domain shown below is 1.6e-44.
KEKLKENNAPKWVPSLNEVPLHYLKPNSFVKFRCMIQDMFDPEFYMGIYETVNQNTKARV LHFGKYRDVAECGPQQELDLSSPRSTTSERQTFYCVPVPGESSWVKEAYVNANQARVSPS TSYTPSRHKR
MCM_bind |
---|
PFAM accession number: | PF09739 |
---|---|
Interpro abstract (IPR019140): | This entry represents a family of proteins which are approximately 600 residues in length and contain alternating regions of conservation and low complexity. They are associated components of the mini-chromosome maintenance (MCM) complex that acts as a regulator of DNA replication. They bind to the MCM complex during late S phase and promotes the disassembly of the MCM complex from chromatin, thereby acting as a key regulator of pre-replication complex (pre-RC) unloading from replicated DNA. Can dissociate the MCM complex without addition of ATP; probably acts by destabilising interactions of each individual subunits of the MCM complex. Required for sister chromatid cohesion [ (PUBMED:21196493) (PUBMED:20090939) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MCM_bind