The domain within your query sequence starts at position 134 and ends at position 331; the E-value for the MCRS_N domain shown below is 5.7e-98.
RWKPADDLLLINAVLQTNDLTSVHLGVKFSCRFTLREVQERWYALLYDPVISKLACQAMR QLHPEAIAAIQSKALFSKAEEQLLSKVGSSSQPTLETFQDLLHTHPDAFYLARTAKALQA HWQLMKQYYLLEDQTVQPLPKGDQVLNFSDAEDLIDDSKLKDMRDEVLEHELTVADRRQK REIRQLEQELHKWQVLVD
MCRS_N |
---|
PFAM accession number: | PF13325 |
---|---|
Interpro abstract (IPR025999): | This domain is found in plants and higher eukaryotes, and is the N-terminal region of micro-spherule proteins which repress the transactivation activities of Nrf1 (p45 nuclear factor-erythroid 2 (p45 NF-E2)-related factor 1) [ (PUBMED:17014843) ]. In conjunction with DIPA the full-length protein acts as a transcription repressor [ (PUBMED:19187526) ]. The exact function of this domain is not known. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MCRS_N