The domain within your query sequence starts at position 114 and ends at position 319; the E-value for the MCU domain shown below is 3.5e-78.

LQEEDRGIDRVAIYSPDGVRVAASTGIDLLLLDDFKLVINDLTYHVRPPKRDLLSHEDAA
TLNDVKTLVQQLYTTLCIEQHQLNKERELVERLEDLKQQLAPLEKVRIEISRKAEKRTTL
VLWGGLAYMATQFGILARLTWWEYSWDIMEPVTYFITYGSAMAMYAYFVMTRQEYVYPEA
RDRQYLLFFHKGAKKSRFDLEKYNQL

MCU

MCU
PFAM accession number:PF04678
Interpro abstract (IPR006769):

This entry represents the C-terminal domain of coiled-coil domain containing protein 109.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MCU