The domain within your query sequence starts at position 34 and ends at position 149; the E-value for the MCU domain shown below is 2.4e-19.
TVEPQDDGSEIPASTLMDTLLMTDFKLIINKLRYDIRCHKKEEPSGEHMTELENTKSLVH RLFTILHLEEIQKRRERHLMAKIDHLQEQLRPLEQVKAAIEARSEANTSGLLWAGL
MCU |
---|
PFAM accession number: | PF04678 |
---|---|
Interpro abstract (IPR006769): | This entry represents the C-terminal domain of MCU, which is a mitochondrial inner membrane calcium uniporter that mediates calcium uptake into mitochondria [ (PUBMED:21685888) (PUBMED:21685886) (PUBMED:23101630) ]. This domain can also be found in MCUb, which negatively regulates the activity of MCU [ (PUBMED:23900286) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MCU