The domain within your query sequence starts at position 9 and ends at position 172; the E-value for the MDM1 domain shown below is 8.3e-55.
SEYQRNFLWKKSYLSESYNPSVGQKYSWAGLRSDQLGITKEPGFISKRRVPYHDPQISKY LEWNGTVRKKDTLVPPEPQAFGTPKPQEAEQGEDANQEAVLSLEASRVPKRTRSHSADSR AEGVSDTVEKHQGVTRSHAPVSADVELRPSSKQPLSQSIDPRVF
MDM1 |
---|
PFAM accession number: | PF15501 |
---|---|
Interpro abstract (IPR029136): | MDM1 is a microtubule-binding protein that negatively regulates centriole duplication. It binds to and stabilizes microtubules [ (PUBMED:26337392) ]. |
GO process: | negative regulation of centriole replication (GO:0046600) |
GO function: | microtubule binding (GO:0008017) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MDM1