The domain within your query sequence starts at position 1 and ends at position 174; the E-value for the MEA1 domain shown below is 1.6e-121.

MAAVVLGGDTMGPERIFPNQTEDLGPHQGPTEGTGDWSSEEPEEEQEETGAGPAGYSYQP
LNQDPEQEEVELAPVGEGEDGAADIQDRIQALGLHLPDPPLESEDEDEEGAAALSSHSSI
PMDPEHVELVKRTMAGVSLPAPGVPAWAREISDAQWEDVVQKALQARQASPAWK

MEA1

MEA1
PFAM accession number:PF06910
Interpro abstract (IPR009685):

This family consists of several mammalian male enhanced antigen 1 (MEA1) proteins. The Mea-1 gene is found to be localised in primary and secondary spermatocytes and spermatids, but the protein products are detected only in spermatids. Intensive transcription of Mea-1 gene and specific localisation of the gene product suggest that Mea-1 may play a important role in the late stage of spermatogenesis [(PUBMED:8907304)].

GO process:spermatogenesis (GO:0007283)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MEA1