The domain within your query sequence starts at position 190 and ends at position 399; the E-value for the MFAP1 domain shown below is 1.6e-81.

DSEDEMEPRLKPVFIRKKDRVTVQEREAEALKQKELEQEAKRMAEERRKYTLKIVEEETK
KELEENKRSLAALDALNTDDENDEEEYEAWKVRELKRIKREREDREALEKEKAEIERMRN
LTEEERRAELRANGKVITNKAVKGKYKFLQKYYHRGAFFMDEDEEVYKRDFSAPTLEDHF
NKTILPKVMQVKNFGRSGRTKYTHLVDQDT

MFAP1

MFAP1
PFAM accession number:PF06991
Interpro abstract (IPR009730):

This entry represents the C terminus (approximately 300 residues) of eukaryotic micro-fibrillar-associated protein 1, which is a component of elastin-associated microfibrils in the extracellular matrix [(PUBMED:8174780)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MFAP1