The domain within your query sequence starts at position 177 and ends at position 514; the E-value for the MFS_1 domain shown below is 3.1e-20.

MIQPLIIFGVMLGSITFSYLSDRFGRRMALWCTSIGVFFFGIASLFIFDYLSFMITRFFL
VMASSGYFVVVFVYVMEIIGKKARTWASIHLNTFFAIGAMLVALASYLLKTWWLYQIILC
IVTTPFILCCWMLPETPFWLLSEGRYKEAQGTVDTMAVWNKSSSCDLVELLSLDVTRSHN
KSPHSIRKHRLADLFHNLDVAKMTLIVWLDWFTANLGYYMFGKEVIRRKENEPLYLLLVG
AMEIPAYICLCIWLKRVGRRKTMLLFLLVSSLTCMLHVVMPSDYKTAKRMVALLVKSVIS
SVFAFIYLYTAELYPTTVRCLAVGSSNMVSHVSSIFIP

MFS_1

MFS_1
PFAM accession number:PF07690
Interpro abstract (IPR011701): Among the different families of transporter, only two occur ubiquitously in all classifications of organisms. These are the ATP-Binding Cassette (ABC) superfamily and the Major Facilitator Superfamily (MFS). The MFS transporters are single-polypeptide secondary carriers capable only of transporting small solutes in response to chemiosmotic ion gradients [(PUBMED:9529885), (PUBMED:9868370)].
GO process:transmembrane transport (GO:0055085)
GO component:integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MFS_1