The domain within your query sequence starts at position 28 and ends at position 88; the E-value for the MFS_1_like domain shown below is 1.6e-7.
ACVTPFLTLYLRQLGVAAPLVGILMGTKHLIATCWIPFCAFLAKRYQKRRMFLTGSLLSS A
MFS_1_like |
---|
PFAM accession number: | PF12832 |
---|---|
Interpro abstract (IPR024989): | This domain is found in a number of major facilitator superfamily proteins. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MFS_1_like