The domain within your query sequence starts at position 66 and ends at position 346; the E-value for the MFS_3 domain shown below is 6.5e-9.

VFGRFADQCGARAALSLSFLAASALYLLLVASCSPALPGVFLLFASRIPSALMHTLPAAQ
MVITDLTAPTERPAALGRLGLCFGIGIIFGSLLGGTLNTAYGIQCPAILAFVVTLLGAVL
SFTCVPATTKEASVQSAPQGGTKASVFDLKAITRLLLLPRVLPVFLVKVISGLPSGLFLV
MFSIISMDFFQLEAAQAGYLMSFFGILQMMIQGLVIGRLSTHFPEEALLRSSVLVFAVVG
LGMALMSSVLHFCFLMPGLVFSLCTLNVVTDSMLTKAVSAS

MFS_3

MFS_3
PFAM accession number:PF05977
Interpro abstract (IPR010290):

This is a family of transport proteins. Members of this family include a protein responsible for the secretion of the ferric chelator, enterobactin [(PUBMED:12068807)], and a protein involved in antibiotic resistance [(PUBMED:15336408)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MFS_3