The domain within your query sequence starts at position 269 and ends at position 464; the E-value for the MFS_4 domain shown below is 4.3e-11.

SRRKLSPPKKVFNFALFKETTYAVWAAGIPLALFGYFVPYVHLMNHVKERFQDVNNKEVL
FMCIGITSGVGRLLFGRIADYLPGVKKVYLQVLSFFFIGLMSMMIPLCSAFGALIAVCLA
MGLFDGCFISIMAPIAFELVGPQDASQAIGFLLGFMSIPMTVGPPIAGLLHDKLGTYDVA
FYLAGIPPFVGGVVLC

MFS_4

MFS_4
PFAM accession number:PF06779
Interpro abstract (IPR010645):

This entry represents a domain found in putative bacterial membrane proteins which may be sugar transporters. Members carry twelve transmembrane regions which are characteristic of members of the major facilitator sugar-transporter superfamily.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MFS_4