The domain within your query sequence starts at position 31 and ends at position 200; the E-value for the MHC_I_2 domain shown below is 2.6e-110.

DAHSLRCNLTIKAPTPADEVKCFVGEILILHLSNINKTMTSGDPGETANATEVGECLTQP
LKDLCQKLRDKVSNTKVDTHKTNGYPHLQVTMIYPQSQGQTPSATWEFNISDSYFFTFYT
EIMSWRSANDESGVIMNKWKDDGEFVKQLKFLIHGCSQKMDEFLKQSKEK

MHC_I_2

MHC_I_2
PFAM accession number:PF14586
Interpro abstract (IPR029287):

Members of this group are known as retinoic acid early inducible proteins (RAE-1) [(PUBMED:8882725), (PUBMED:10894171)]. They are ligands for the activating immunoreceptor NKG2D, which is widely expressed on natural killer cells, T cells, and macrophages [(PUBMED:11825567)]. There is a considerable diversity of NKG2D ligands. In mice, the ligands include, among others, five members of the retinoic acid early inducible gene 1 (RAE-1; alpha-epsilon) [(PUBMED:14523385)].

RAE-1 proteins are distant major histocompatibility complex (MHC) class I homologues, comprising isolated alpha1-alpha2 platform domains [(PUBMED:11825567)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MHC_I_2