The domain within your query sequence starts at position 154 and ends at position 221; the E-value for the MIB_HERC2 domain shown below is 5.5e-31.

GARVVRGVDWQWEDQDGGNGRRGKVTEIQDWSASSPHSAAYVLWDNGAKNLYRVGFEGMS
DLKCVQDA

MIB_HERC2

MIB_HERC2
PFAM accession number:PF06701
Interpro abstract (IPR010606):

Mib is a RING ubiquitin ligase in the Notch pathway. Mib interacts with the intracellular domain of Delta to promote its ubiquitylation and internalisation. Cell transplantation studies suggest that mib function is essential in the signalling cell for efficient activation of Notch in neighbouring cells. This domain has been named 'mib/herc2 domain' in [(PUBMED:12530964)] and usually the protein also contains an E3 ligase domain (either Ring or Hect).

GO process:protein ubiquitination (GO:0016567)
GO function:ubiquitin-protein transferase activity (GO:0004842), metal ion binding (GO:0046872)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MIB_HERC2