The domain within your query sequence starts at position 296 and ends at position 485; the E-value for the MIEAP domain shown below is 1.2e-65.

VDFCLLTDFIQEICCIAFAMQSLEPPLDIAFGADGEIFNDCKYRRSYDSDFTAPLVFYHV
WPALMENDCVIMKGEAVTKRGAFWSSVRPVMRCRSRSLSPICPRNHFGISTVHSCVAIPA
ENLVSRSRSPSPIRCTFARY

MIEAP

• PFAM accession number: PF16026
• Interpro abstract (IPR031981):

  This domain is found at the C terminus of mitochondria-eating proteins. Proteins containing this domain regulate mitochondrial quality. They have a role in damaged mitochondrial protein degradation and in damaged mitochondria degradation [ (PUBMED:21264221) (PUBMED:21264228) (PUBMED:22292033) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MIEAP