The domain within your query sequence starts at position 4 and ends at position 227; the E-value for the MIP domain shown below is 3e-85.

EIKKKLFWRAVVAEFLAMTLFVFISIGSALGFNYPLERNQTLVQDNVKVSLAFGLSIATL
AQSVGHISGAHLNPAVTLGLLLSCQISILRAVMYIIAQCVGAIVATAILSGITSSLVDNS
LGRNDLAHGVNSGQGLGIEIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSVALGHLLA
IDYTGCGINPARSFGSAVLTRNFSNHWIFWVGPFIGGALAVLIY

MIP

MIP
PFAM accession number:PF00230
Interpro abstract (IPR000425):

The major intrinsic protein (MIP) family is large and diverse, possessing over 100 members that form transmembrane channels. These channel proteins function in water, small carbohydrate (e.g., glycerol), urea, NH3, CO2 and possibly ion transport, by an energy independent mechanism. They are found ubiquitously in bacteria, archaea and eukaryotes.

The MIP family contains two major groups of channels: aquaporins and glycerol facilitators. The known aquaporins cluster loosely together as do the known glycerol facilitators. MIP family proteins are believed to form aqueous pores that selectively allow passive transport of their solute(s) across the membrane with minimal apparent recognition. Aquaporins selectively transport water (but not glycerol) while glycerol facilitators selectively transport glycerol but not water. Some aquaporins can transport NH3 and CO2. Glycerol facilitators function as solute nonspecific channels, and may transport glycerol, dihydroxyacetone, propanediol, urea and other small neutral molecules in physiologically important processes. Some members of the family, including the yeast FPS protein and tobacco NtTIPA may transport both water and small solutes.

The structures of various members of the MIP family have been determined by means of X-ray diffraction [(PUBMED:11780053), (PUBMED:10957645), (PUBMED:11039922)], revealing the fold to comprise a right-handed bundle of 6 transmembrane (TM) alpha-helices [(PUBMED:11780053), (PUBMED:10957645), (PUBMED:11039922)]. Similarities in the N-and C-terminal halves of the molecule suggest that the proteins may have arisen through tandem, intragenic duplication of an ancestral protein that contained 3 TM domains [(PUBMED:1715617)].

GO process:transmembrane transport (GO:0055085)
GO component:membrane (GO:0016020)
GO function:channel activity (GO:0015267)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MIP