SMART: Pfam domain MITF_TFEB_C_3

The domain within your query sequence starts at position 112 and ends at position 265; the E-value for the MITF_TFEB_C_3_N domain shown below is 1e-57.

RVLLRQQLMRAQAQEQERRERREQAAAAPFPSPAPASPAISVIGVSAGGHTLSRPPPAQV
PREVLKVQTHLENPTRYHLQQARRQQVKQYLSTTLGPKLASQALTPPPGPSSAQPLPAPE
TAHATGPTGSAPNSPMALLTIGSSSEKEIDDVID

MITF_TFEB_C_3_N

PFAM accession number:	PF15951
Interpro abstract (IPR031867):	This entry represents a domain found at the N terminus of the MiT/TFE family members, which include MITF (microphthalmia-associated transcription factor) and its related family members TFE3, TFEB and TFEC [ (PUBMED:7958932) ]. They are basic helix-loop-helix leucine zipper transcription factors found in chordata. These transcription factors heterodimerize with each other and bind to the E-box core sequence (3'-CANNTG-5') [ (PUBMED:15507434) (PUBMED:26240184) ].

PFAM accession number:

PF15951

Interpro abstract (IPR031867):

This entry represents a domain found at the N terminus of the MiT/TFE family members, which include MITF (microphthalmia-associated transcription factor) and its related family members TFE3, TFEB and TFEC [ (PUBMED:7958932) ]. They are basic helix-loop-helix leucine zipper transcription factors found in chordata. These transcription factors heterodimerize with each other and bind to the E-box core sequence (3'-CANNTG-5') [ (PUBMED:15507434) (PUBMED:26240184) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MITF_TFEB_C_3_N