The domain within your query sequence starts at position 63 and ends at position 220; the E-value for the MITF_TFEB_C_3_N domain shown below is 2e-69.
RIGLRMQLMREQAQQEEQRERMQQQAVMHYMQQQQQQQQQLGGPPTPAINTPVHFQSPPP VPGEVLKVQSYLENPTSYHLQQSQHQKVREYLSETYGNKFAAHVSPAQGSPKPAPAASPG VRAGHVLSTSAGNSAPNSPMAMLHISSNPEKEFDDVID
MITF_TFEB_C_3_N |
---|
PFAM accession number: | PF15951 |
---|---|
Interpro abstract (IPR031867): | This entry represents a domain found at the N terminus of the MiT/TFE family members, which include MITF (microphthalmia-associated transcription factor) and its related family members TFE3, TFEB and TFEC [ (PUBMED:7958932) ]. They are basic helix-loop-helix leucine zipper transcription factors found in chordata. These transcription factors heterodimerize with each other and bind to the E-box core sequence (3'-CANNTG-5') [ (PUBMED:15507434) (PUBMED:26240184) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MITF_TFEB_C_3_N