The domain within your query sequence starts at position 2 and ends at position 113; the E-value for the MLANA domain shown below is 8.2e-50.
PQEDIHFGYPRKGHRRSYVTAEEAAGIGILIVVLGIALLIGCWYCRRRSGYRTLMDKRRH IGIQKTSRERCSCESPDHQDSRLSSQEKSHQPVVPNAPPAYEKLSSPPPYSP
MLANA |
 |
|---|
| PFAM accession number: | PF14991 |
|---|---|
| Interpro abstract (IPR029242): | Melan-A, also known as melanoma antigen recognised by T-cells 1, or MART-1, is a protein that in humans is encoded by the MLANA gene. It is required for the function of the melanosomal matrix protein PMEL17/GP100 and thus plays an important role in regulating mammalian pigmentation [ (PUBMED:15695812) ]. Melan-A is a member of the MAGE gene family [ (PUBMED:11454705) ] and is a tumour associated antigen. Clinically, the protein may serve as an anti-cancer vaccine [ (PUBMED:24045055) ]. |
| GO component: | melanosome (GO:0042470) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MLANA