The domain within your query sequence starts at position 312 and ends at position 432; the E-value for the MMR_HSR1 domain shown below is 3.4e-13.

SVGFIGYPNVGKSSVINTLRSKKVCNVAPIAGETKVWQYITLMRRIFLIDCPGVVYPSED
SETDIVLKGVVQVEKIKAPQDHIGAVLERAKPEYISKTYKIESWENAEDFLEKLALRTGK
L

MMR_HSR1

MMR_HSR1
PFAM accession number:PF01926
Interpro abstract (IPR006073): Several proteins have recently been shown to contain the 5 structural motifs characteristic of GTP-binding proteins [(PUBMED:1449490)]. These include murine DRG protein; GTP1 protein from Schizosaccharomyces pombe; OBG protein from Bacillus subtilis [(PUBMED:12429099)]; ferrous iron transport protein B [(PUBMED:20123128)] and several others.
GO function:GTP binding (GO:0005525)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MMR_HSR1