The domain within your query sequence starts at position 184 and ends at position 289; the E-value for the MMR_HSR1_Xtn domain shown below is 9.6e-50.

GGGISFNSTVTLTQCSEKLVQLILHEYKIFNAEVLFREDCSPDDFIDVIVGNRVYMPCLY
VYNKIDQISMEEVDRLARKPNSVVISCGMKLNLDYLLEMLWEYLAL

MMR_HSR1_Xtn

MMR_HSR1_Xtn
PFAM accession number:PF16897
Interpro abstract (IPR031662): This entry represents a domain C-terminal to IPR006073 in a group of GTP binding proteins. Its function is not clear.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MMR_HSR1_Xtn