The domain within your query sequence starts at position 3 and ends at position 265; the E-value for the MMS19_N domain shown below is 9.8e-97.

VEALGSSLENAEPRTRARGAQLLSQVLLQCHSLLSEKEVVHLILFYENRLKDHHLVVPSV
LQGLRALSMSVALPPGLAVSVLKAIFQEVHVQSLLQVDRHTVFSIITNFMRSREEELKGL
GADFTFGFIQVMDGEKDPRNLLLAFRIVHDLISKDYSLGPFVEELFEVTSCYFPIDFTPP
PNDPYGIQREDLILSLRAVLASTPRFAEFLLPLLIEKVDSEILSAKLDSLQTLNACCAVY
GQKELKDFLPSLWASIRRESNQR

MMS19_N

MMS19_N
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MMS19_N