The domain within your query sequence starts at position 51 and ends at position 167; the E-value for the MMS19_N domain shown below is 1.5e-31.

VEALGSSLENAEPRTRARGAQLLSQVLLQCHSLLSEKEVVHLILFYENRLKDHHLVVPSV
LQGLRALSMSVALPPGLAVSVLKAIFQEVHVQSLLQVDRHTVFSIITNFMRSREEGD

MMS19_N

MMS19_N
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MMS19_N