SMART: Pfam domain MMS22L

The domain within your query sequence starts at position 202 and ends at position 323; the E-value for the MMS22L_N domain shown below is 2.2e-61.

DKSFWNWLNKLLRTLFEKSSDQRRSSVSLTQAKDPLGFSWWISVHVASLYQIDRHGVSDK
MKQMESNWSFIEELLKRSVTVQDSILEEQLRMHLHCCLTLCDFWEPNISVVTILWEYYSK
NL

MMS22L_N

PFAM accession number:	PF14910
Interpro abstract (IPR029425):	This entry represents the N-terminal of the MMS22L (Methyl methanesulfonate-sensitivity protein 22-like) protein. Methyl methanesulfonate-sensitivity protein 22-like (MMS22L) is a component of the MMS22L-TONSL complex, a complex that stimulates the recombination-dependent repair of stalled or collapsed replication forks [ (PUBMED:21055983) ]. The MMS22L-TONSL complex is required to maintain genome integrity during DNA replication by promoting homologous recombination-mediated repair of replication fork-associated double-strand breaks [ (PUBMED:21055984) (PUBMED:21055985) ]. It may act by mediating the assembly of RAD51 filaments on ssDNA [ (PUBMED:21055985) ].

PFAM accession number:

PF14910

Interpro abstract (IPR029425):

This entry represents the N-terminal of the MMS22L (Methyl methanesulfonate-sensitivity protein 22-like) protein.

Methyl methanesulfonate-sensitivity protein 22-like (MMS22L) is a component of the MMS22L-TONSL complex, a complex that stimulates the recombination-dependent repair of stalled or collapsed replication forks [ (PUBMED:21055983) ]. The MMS22L-TONSL complex is required to maintain genome integrity during DNA replication by promoting homologous recombination-mediated repair of replication fork-associated double-strand breaks [ (PUBMED:21055984) (PUBMED:21055985) ]. It may act by mediating the assembly of RAD51 filaments on ssDNA [ (PUBMED:21055985) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MMS22L_N