The domain within your query sequence starts at position 392 and ends at position 690; the E-value for the MMS22L_N domain shown below is 4.6e-155.
VQNSSFSISWLPLKGLTNIIKSPLSMLTLVRNCCSDKQDPDLYKSSSSYIIFLCILAKVV KKAMRTSGPHPWKQVKGRIYSKFHQKRMEELTEVGLQNFFSLFLLLAAVAEIEDVASHVL DLLRFLRPASMSSHGALVWKGQMAFLLMYAQKNLDIGVWAEKLSCEFQEKAKEFLVSKND EMVQRHALWTLLCIYIDGVQEVFETSSCLYPSHEHLLNDGFSMLLPACRESELRTVLNFL QAVLARIRSVHQQLCQELQRENVDLTVQSSLSAKERPLAAVAGALWRHFFSFLKSQRMT
MMS22L_N |
---|
PFAM accession number: | PF14910 |
---|---|
Interpro abstract (IPR029425): | This entry represents the N-terminal of the MMS22L (Methyl methanesulfonate-sensitivity protein 22-like) protein. Methyl methanesulfonate-sensitivity protein 22-like (MMS22L) is a component of the MMS22L-TONSL complex, a complex that stimulates the recombination-dependent repair of stalled or collapsed replication forks [ (PUBMED:21055983) ]. The MMS22L-TONSL complex is required to maintain genome integrity during DNA replication by promoting homologous recombination-mediated repair of replication fork-associated double-strand breaks [ (PUBMED:21055984) (PUBMED:21055985) ]. It may act by mediating the assembly of RAD51 filaments on ssDNA [ (PUBMED:21055985) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MMS22L_N