SMART: Pfam domain MMgT

The domain within your query sequence starts at position 10 and ends at position 98; the E-value for the MMgT domain shown below is 3.8e-17.

MGVGLFALTHAAFSAAQHRSHARLTEKKYEPLPADIVLQTLLAFALTCYGVVHTAGDFRD
RDATSELKDMTFDTLRNRPSFYVFHRSGY

MMgT

PFAM accession number:	PF10270
Interpro abstract (IPR018937):	This entry represents a novel family of membrane magnesium transporters (MMgT) [ (PUBMED:18057121) ]. The proteins, MMgT1 (also known as ER membrane protein complex subunit 5) and MMgT2, are localised to the Golgi complex and post-Golgi vesicles, including the early endosomes, suggesting that they may provide regulated pathways for Mg2+ transport in the Golgi and post-Golgi organelles of epithelium-derived cells [ (PUBMED:18057121) ].

PFAM accession number:

PF10270

Interpro abstract (IPR018937):

This entry represents a novel family of membrane magnesium transporters (MMgT) [ (PUBMED:18057121) ]. The proteins, MMgT1 (also known as ER membrane protein complex subunit 5) and MMgT2, are localised to the Golgi complex and post-Golgi vesicles, including the early endosomes, suggesting that they may provide regulated pathways for Mg2+ transport in the Golgi and post-Golgi organelles of epithelium-derived cells [ (PUBMED:18057121) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MMgT