The domain within your query sequence starts at position 9 and ends at position 101; the E-value for the MMgT domain shown below is 8.1e-24.

LMGVGLFALTHAAFSAAQHRSHARLTEKKYEPLPADIVLQTLLAFALTCYGVVHTAGDFR
DRDATSELKDMTFDTLRNRPSFYVFHRSGYRLF

MMgT

MMgT
PFAM accession number:PF10270
Interpro abstract (IPR018937):

This entry represents a novel family of membrane magnesium transporters (MMgT) [ (PUBMED:18057121) ]. The proteins, MMgT1 (also known as ER membrane protein complex subunit 5) and MMgT2, are localised to the Golgi complex and post-Golgi vesicles, including the early endosomes, suggesting that they may provide regulated pathways for Mg2+ transport in the Golgi and post-Golgi organelles of epithelium-derived cells [ (PUBMED:18057121) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MMgT