The domain within your query sequence starts at position 21 and ends at position 93; the E-value for the MNNL domain shown below is 2.2e-28.

SSGVFELKLQEFVNKKGLLGNRNCCRGGSGPPCACRTFFRVCLKHYQASVSPEPPCTYGS
AVTPVLGVDSFSL

MNNL

MNNL
PFAM accession number:PF07657
Interpro abstract (IPR011651): This entry represents a region of conserved sequence at the N terminus of several Notch ligand proteins, including Delta-like protein 1 (DLL1) and 4 (DLL4) [(PUBMED:25715738), (PUBMED:25700513)].
GO process:multicellular organism development (GO:0007275), Notch signaling pathway (GO:0007219)
GO component:integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MNNL