SMART: Pfam domain MOEP19

The domain within your query sequence starts at position 2 and ends at position 88; the E-value for the MOEP19 domain shown below is 1.9e-32.

HPQWVKVPEDLKDPEVFQVQSLVLKSLFGPQGSQMSRIEQVSQAMFELKNLESPKELIKV
FIYDSQNNKVWANRMLQSMAERYRLCQ

MOEP19

PFAM accession number:	PF16005
Interpro abstract (IPR031952):	This entry represents a KH-like RNA-binding motif found in MOEP19 (also known as Ooep19 or Floped) [ (PUBMED:18191828) ], Filia (also known as Ecat or KH domain-containing protein 3) [ (PUBMED:22276159) (PUBMED:20823540) ], and related proteins. MOEP19 is a mammalian protein expressed during early embryogenesis [ (PUBMED:18191828) ]. Filia is expressed in oocytes and embryo [ (PUBMED:19376971) ]. RNA-binding domain may mediate RNA transcript regulation in oogenesis and embryogenesis.

PFAM accession number:

PF16005

Interpro abstract (IPR031952):

This entry represents a KH-like RNA-binding motif found in MOEP19 (also known as Ooep19 or Floped) [ (PUBMED:18191828) ], Filia (also known as Ecat or KH domain-containing protein 3) [ (PUBMED:22276159) (PUBMED:20823540) ], and related proteins.

MOEP19 is a mammalian protein expressed during early embryogenesis [ (PUBMED:18191828) ]. Filia is expressed in oocytes and embryo [ (PUBMED:19376971) ]. RNA-binding domain may mediate RNA transcript regulation in oogenesis and embryogenesis.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MOEP19