The domain within your query sequence starts at position 6 and ends at position 92; the E-value for the MOEP19 domain shown below is 3.2e-25.
RKGWWNVPDYFHSPLVFDMEEDKEDYIFGPHDEYLHTLEVHSNTLIQLERWFTPTGQTRV TVVGPLKARLWVMDMIRKVGSKNNLDQ
MOEP19 |
---|
PFAM accession number: | PF16005 |
---|---|
Interpro abstract (IPR031952): | This entry represents a KH-like RNA-binding motif found in MOEP19 (also known as Ooep19 or Floped) [ (PUBMED:18191828) ], Filia (also known as Ecat or KH domain-containing protein 3) [ (PUBMED:22276159) (PUBMED:20823540) ], and related proteins. MOEP19 is a mammalian protein expressed during early embryogenesis [ (PUBMED:18191828) ]. Filia is expressed in oocytes and embryo [ (PUBMED:19376971) ]. RNA-binding domain may mediate RNA transcript regulation in oogenesis and embryogenesis. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MOEP19