The domain within your query sequence starts at position 2002 and ends at position 2255; the E-value for the MOR2-PAG1_C domain shown below is 9.9e-78.

ATIFWIATSLLESDYEYEYLLALRLLSKLLTHLPLDKSESREKIENVQSKLKWSNFPGLQ
QLFLKGFTSVSTQEMTVHLLSQLISVSKHTLVDPSQVSGFPLNILCLLPHLIQHFDSPTQ
FCKETASRIAKVCAEEKCPTLVNLAHMMSLYSTHTYSRDCSNWINVVCRYLHDSFSEATF
SLVTYLAELLEKGLSSMQQSLLQIIYSLLSHIDLSAAPVKQFNLEIIKIIGKYVQSPYWK
EALNILKLVVSRSA

MOR2-PAG1_C

MOR2-PAG1_C
PFAM accession number:PF14225
Interpro abstract (IPR025481):

This domain represents the conserved C-terminal region of proteins that are involved in cell morphogenesis [(PUBMED:12234926)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MOR2-PAG1_C