The domain within your query sequence starts at position 116 and ends at position 649; the E-value for the MOR2-PAG1_N domain shown below is 3e-172.

LERRDLAVDFIFCLVLVEVLKQIPVHPVPDPLVHEVLNLAFKHFKHKEGYSGTNTGNVHI
IADLYAEVIGVLAQSKFQAVRKKFVTELKELRQKEQSPHVVQSVISLIMGMKFFRVKMYP
VEDFEASFQFMQECAQYFLEVKDKDIKHALAGLFVEILIPVAAAVKNEVNVPCLKNFVEM
LYQTTFELSSRKKHSLALYPLITCLLCVSQKQFFLNNWHIFLQNCLSHLKNKDPKMSRVA
LESLYRLLWVYVIRIKCESNTVTQSRLMSIVSALFPKGSRSVVPRDTPLNIFVKIIQFIA
QERLDFAMKEIIFDLLSVGKSTKTFTINPERMNIGLRVFLVIADSLQQKDGDPPMPTTGV
ILPSGNTLRVKKIFLNKTLTDEEAKVIGMSVYYPQVRKALDSILRHLDKEVGRPMCMTSV
QMSNKEPEDMITGERKPKIDLFRTCIAAIPRLIPDGMSRTDLIELLARLTIHMDEELRAL
AFNTLQALMLDFPDWREDVLSGFVYFIVREVTDVHPTLLDNAVKMLVQLINQWK

MOR2-PAG1_N

MOR2-PAG1_N
PFAM accession number:PF14222
Interpro abstract (IPR025614):

This entry represents the conserved N-terminal domain of proteins that are involved in cell morphogenesis. Among these are furry proteins and homologues [(PUBMED:11526084), (PUBMED:16061630)], and proteins PAG1 [(PUBMED:11854408)] and Mor2 [(PUBMED:12234926)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MOR2-PAG1_N