The domain within your query sequence starts at position 1772 and ends at position 1906; the E-value for the MOR2-PAG1_mid domain shown below is 4.9e-10.

LPQMTQEVEDVEAATETDEKASKLIEFLTTRAFGPLWCHEDITPKNQNSKSAEQLSNFLR
HVVSVFKDSRSGFHLEQHLSEVALQTALASSSRHYAGRSFQIFRALKQPLSAHALSDLLS
RLVEVIGEHGDEIQG

MOR2-PAG1_mid

MOR2-PAG1_mid
PFAM accession number:PF14228
Interpro abstract (IPR029473):

This entry represents the central region of proteins that are involved in cell morphogenesis. Among these are furry proteins from flies [(PUBMED:11526084), (PUBMED:16061630)], proteins PAG1 from budding yeasts [(PUBMED:11854408)] and Mor2 from fission yeasts [(PUBMED:12234926)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MOR2-PAG1_mid