The domain within your query sequence starts at position 1 and ends at position 74; the E-value for the MOSC_N domain shown below is 4.2e-15.

MVTARQEPRLVLISLTCEDDTLTLSAAYTKDLLLPITPPATNPLLQCRVHGLEIQGRDCG
EDAAQWVSSFLKMQ

MOSC_N

MOSC_N
PFAM accession number:PF03476
Interpro abstract (IPR005303):

This domain is found to the N terminus of MOSC domain ( IPR005302 ). The function of this domain is unknown, however it is predicted to adopt a beta barrel fold.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MOSC_N