The domain within your query sequence starts at position 1 and ends at position 85; the E-value for the MPC domain shown below is 5.5e-39.

MHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALCCYSLTFMRFAYKVQPRNWLLFACH
VTNEVAQLIQGGRLINYEMSKRPSA

MPC

MPC
PFAM accession number:PF03650
Interpro abstract (IPR005336):

This entry represents the mitochondrial pyruvate carrier proteins, including Mpc 1/2 and their homologues. They mediate the uptake of pyruvate into mitochondria [ (PUBMED:22628558) ]. In humans, Mpc1 and Mpc2 associate to form an ~150-kilodalton complex in the inner mitochondrial membrane [ (PUBMED:22628558) ].

GO process:mitochondrial pyruvate transmembrane transport (GO:0006850)
GO component:mitochondrial inner membrane (GO:0005743)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MPC