The domain within your query sequence starts at position 27 and ends at position 127; the E-value for the MPC domain shown below is 2.5e-42.
KLRPLYNHPAGPRTVFFWAPIMKWGLVCAGLADMARPAEKLSTAQSTVLMATGFIWSRYS LVIIPKNWSLFAVNFFVGSAGASQLFRIWRYNQELKSKGIQ
MPC |
---|
PFAM accession number: | PF03650 |
---|---|
Interpro abstract (IPR005336): | This entry represents the mitochondrial pyruvate carrier proteins, including Mpc 1/2 and their homologues. They mediate the uptake of pyruvate into mitochondria [ (PUBMED:22628558) ]. In humans, Mpc1 and Mpc2 associate to form an ~150-kilodalton complex in the inner mitochondrial membrane [ (PUBMED:22628558) ]. |
GO process: | mitochondrial pyruvate transmembrane transport (GO:0006850) |
GO component: | mitochondrial inner membrane (GO:0005743) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MPC