SMART: Pfam domain MPP6

The domain within your query sequence starts at position 7 and ends at position 136; the E-value for the MPP6 domain shown below is 8.4e-46.

TKLSKNLLRMKFMQRGLDSETKKQLEEEERKMISDEHWYLDLPELKEKESFIVEEQSFSL
CEDLLYGRMSFRGFNPEVEKLMLQMNSKNRAEAAEEDETVEVDVSDEEMARRYETLVGTI
GKKFVKKRDR

MPP6

PFAM accession number:	PF10175
Interpro abstract (IPR019324):	This entry describes M-phase phosphoprotein 6 (MPP6), which is involved in generation of the 3' end of the 5.8S rRNA precursor [ (PUBMED:16396833) ]. MPP6 is required for the integrity maintenance of the rRNA processing complex as it mediates the interaction between MTR4 (RNA helicase) and RRP6 (an 3'-5' exonuclease), and the recruitment of Nuclear VCP-like 2 (NVL2) to the nuclear exosome [ (PUBMED:26166824) ].

PFAM accession number:

PF10175

Interpro abstract (IPR019324):

This entry describes M-phase phosphoprotein 6 (MPP6), which is involved in generation of the 3' end of the 5.8S rRNA precursor [ (PUBMED:16396833) ]. MPP6 is required for the integrity maintenance of the rRNA processing complex as it mediates the interaction between MTR4 (RNA helicase) and RRP6 (an 3'-5' exonuclease), and the recruitment of Nuclear VCP-like 2 (NVL2) to the nuclear exosome [ (PUBMED:26166824) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MPP6