The domain within your query sequence starts at position 55 and ends at position 157; the E-value for the MRI domain shown below is 2.6e-50.
TVYCMNEAEMVDVALGILIEGRKQEKPWEQRSLEATDKLQLSPPCSSSPGSSSEEEDSRI SSLAPGLSPPRGPEASDSPCSRSPEEEKEEEDALKYVREIFFS
MRI |
---|
PFAM accession number: | PF15325 |
---|---|
Interpro abstract (IPR028278): | CYREN is a cell-cycle-specific inhibitor of classical non-homologous end joining (cNHEJ) that promotes error-free repair by homologous recombination during the S and G2 phases (when sister chromatids are present) [ (PUBMED:28959974) ]. It was originally known as MRI (modulator of retrovirus infection), as it was isolated as a gene that could reverse the resistance to retroviral infection in a mutant cell line [ (PUBMED:17043244) ]. |
GO process: | negative regulation of double-strand break repair via nonhomologous end joining (GO:2001033) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MRI