The domain within your query sequence starts at position 55 and ends at position 90; the E-value for the MRI domain shown below is 4.6e-21.

TVYCMNEAEMVDVALGILIEGRKQEKPWEQRSLEAT

MRI

MRI
PFAM accession number:PF15325
Interpro abstract (IPR028278):

CYREN is a cell-cycle-specific inhibitor of classical non-homologous end joining (cNHEJ) that promotes error-free repair by homologous recombination during the S and G2 phases (when sister chromatids are present) [ (PUBMED:28959974) ]. It was originally known as MRI (modulator of retrovirus infection), as it was isolated as a gene that could reverse the resistance to retroviral infection in a mutant cell line [ (PUBMED:17043244) ].

GO process:negative regulation of double-strand break repair via nonhomologous end joining (GO:2001033)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MRI