The domain within your query sequence starts at position 62 and ends at position 158; the E-value for the MRP domain shown below is 7e-34.
ASYSSGDSQAIDSHISTSRATPAKGRETRTVKQRRSASKPAFSINHLSGKGLSSSTSHDS SCSLRSATVLRHPVLDESLIREQTKVDHFWGLDDDGD
MRP |
---|
PFAM accession number: | PF09387 |
---|---|
Interpro abstract (IPR032680): | This entry represents the N-terminal domain of animal Sun1 proteins. Sun1 is a nuclear envelope (NE) protein that interacts with nuclear lamin A and cytoplasmic nesprins to provide a physical connection between the nuclear lamina and the cytoskeleton [ (PUBMED:16648470) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MRP