The domain within your query sequence starts at position 62 and ends at position 160; the E-value for the MRP domain shown below is 4.8e-34.

ASYSSGDSQAIDSHISTSRATPAKGRETRTVKQRRSASKPAFSINHLSGKGLSSSTSHDS
SCSLRSATVLRHPVLDESLIREQTKVDHFWGLDDDGDLK

MRP

MRP
PFAM accession number:PF09387
Interpro abstract (IPR032680):

This entry represents the N-terminal domain of animal Sun1 proteins. Sun1 is a nuclear envelope (NE) protein that interacts with nuclear lamin A and cytoplasmic nesprins to provide a physical connection between the nuclear lamina and the cytoskeleton [ (PUBMED:16648470) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MRP