The domain within your query sequence starts at position 13 and ends at position 101; the E-value for the MRP-63 domain shown below is 9e-42.
PGRQWIGKHRRPRTVSFQAKESMIRRLEVEAENHYWLSMPYMTAEQECGHAAERRAQAFE AIKAAATSKFPKHRYIADQLDHLNISKKW
MRP-63 |
 |
|---|
| PFAM accession number: | PF14978 |
|---|---|
| Interpro abstract (IPR016576): | Mitochondrial ribosomal protein 63 is present in the intact 55S subunit of the mitochondrial ribosome. It is not known if it belongs to the 28S or to the 39S subunit [ (PUBMED:11402041) ]. |
| GO component: | mitochondrial ribosome (GO:0005761) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MRP-63