The domain within your query sequence starts at position 13 and ends at position 125; the E-value for the MRP-L27 domain shown below is 1.3e-47.
RGADRMSKWTSKRGPRTFTKSRGAKKTGIYTSDRKFVQIKEMVPEFVVPDLTGFKLKPYV NYRAPAGIDTPLTAKALFQETVAPAIEKDFKEGTFDANNLEKYGFEPTQEGKL
MRP-L27 |
---|
PFAM accession number: | PF09809 |
---|---|
Interpro abstract (IPR019189): | Proteins in this entry are components of the mitochondrial ribosome large subunit. They are also involved in apoptosis and cell cycle regulation. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MRP-L27