The domain within your query sequence starts at position 56 and ends at position 98; the E-value for the MRP-L27 domain shown below is 1.1e-12.
RGADRMSKWTSKRGPRTFTKSRGAKKTGIYTSDRKFVQIKEM
MRP-L27 |
 |
|---|
| PFAM accession number: | PF09809 |
|---|---|
| Interpro abstract (IPR019189): | Proteins in this entry are components of the mitochondrial ribosome large subunit. They are also involved in apoptosis and cell cycle regulation. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MRP-L27