The domain within your query sequence starts at position 43 and ends at position 139; the E-value for the MRP-L46 domain shown below is 2e-22.
WRLSGALCLQRPPLITKALTPLQEEMAGLLQQIEVERSLYSDHELRALDEAQRLAKKKAD LYDEEQEQGITLAQDLEDMWEQAFLQFRPGARETEAD
MRP-L46 |
---|
PFAM accession number: | PF11788 |
---|---|
Interpro abstract (IPR021757): | This domain is found in the L46 subunit of the mammalian mitochondrial ribosome, conserved from plants and fungi. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MRP-L46