The domain within your query sequence starts at position 43 and ends at position 139; the E-value for the MRP-L46 domain shown below is 2e-22.

WRLSGALCLQRPPLITKALTPLQEEMAGLLQQIEVERSLYSDHELRALDEAQRLAKKKAD
LYDEEQEQGITLAQDLEDMWEQAFLQFRPGARETEAD

MRP-L46

MRP-L46
PFAM accession number:PF11788
Interpro abstract (IPR021757):

This is the L46 subunit of the mammalian mitochondrial ribosome, conserved from plants and fungi.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MRP-L46