The domain within your query sequence starts at position 28 and ends at position 197; the E-value for the MRP-S26 domain shown below is 8.1e-59.

KTRHDPPAKSKVGRVQTPPAVDPAEFFVLTERYRQYRETVRALRLEFTLEVRRKLHEARA
GVLAERKAQQAITEHRELMAWNRDENRRMQELRIARLQLEAQAQEVQKAEAQAQRAQEEQ
AWVQLKEQEVLKLQEEAKNFITRENLEARIEEALDSPKSYNWAVTKEGQV

MRP-S26

• PFAM accession number: PF14943
• Interpro abstract (IPR026140):

  Members of this family are a component of the mitochondrial ribosome small subunit (28S,) which comprises a 12S rRNA and about 30 distinct proteins.

• GO component: mitochondrial small ribosomal subunit (GO:0005763)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MRP-S26