The domain within your query sequence starts at position 28 and ends at position 197; the E-value for the MRP-S26 domain shown below is 8.1e-59.
KTRHDPPAKSKVGRVQTPPAVDPAEFFVLTERYRQYRETVRALRLEFTLEVRRKLHEARA GVLAERKAQQAITEHRELMAWNRDENRRMQELRIARLQLEAQAQEVQKAEAQAQRAQEEQ AWVQLKEQEVLKLQEEAKNFITRENLEARIEEALDSPKSYNWAVTKEGQV
MRP-S26 |
---|
PFAM accession number: | PF14943 |
---|---|
Interpro abstract (IPR026140): | Members of this family are a component of the mitochondrial ribosome small subunit (28S,) which comprises a 12S rRNA and about 30 distinct proteins. |
GO component: | mitochondrial small ribosomal subunit (GO:0005763) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MRP-S26