SMART: Pfam domain MRP-S27

The domain within your query sequence starts at position 20 and ends at position 228; the E-value for the MRP-S27 domain shown below is 1.2e-15.

PGVTGSGSACCRCTLGAKRYLLTDNIVKLKEFQHKKIAIAYNLPGTKEIYFRNLEEKLTQ
NKLILKEELKTLLYLCQSLEDVQLAKAVIYRYHAENKNFTLGEYKFGPVFMRLCYELDLE
DSAVELVRDKHLQGFFLDSTSFNILMDMLFTKGKYERALQVLIEMKNQDVRFSKETYILA
FAICYKLNTLESLKICTTLREEALIKGDI

MRP-S27

PFAM accession number:	PF10037
Interpro abstract (IPR034913):	Mammalian pentatricopeptide repeat domain (PPR) proteins are involved in regulation of mitochondrial RNA metabolism and translation and are required for mitochondrial function. The supernumerary mitochondrial ribosomal protein of the small subunit 27 (MRPS27) is not required for mitochondrial RNA processing or the stability of the small ribosomal subunit. However, MRPS27 is required for mitochondrial protein synthesis [ (PUBMED:22841715) ]. Pentatricopeptide repeat-containing protein 2 (PTCD2) is a related mitochondrial PPR protein, although despite their similarity, they may not have the same function [ (PUBMED:18729827) (PUBMED:23635806) ]. PTCD2 has a role in mitochondrial RNA metabolism and downstream effects on mitochondrial translation [ (PUBMED:22051507) (PUBMED:22777840) ]. PTCD2 has been identified as a target for autoantibodies in neurodegenerative disease and is used as a biomarker for Alzheimer disease [ (PUBMED:21826230) ].

PFAM accession number:

PF10037

Interpro abstract (IPR034913):

Mammalian pentatricopeptide repeat domain (PPR) proteins are involved in regulation of mitochondrial RNA metabolism and translation and are required for mitochondrial function. The supernumerary mitochondrial ribosomal protein of the small subunit 27 (MRPS27) is not required for mitochondrial RNA processing or the stability of the small ribosomal subunit. However, MRPS27 is required for mitochondrial protein synthesis [ (PUBMED:22841715) ].

Pentatricopeptide repeat-containing protein 2 (PTCD2) is a related mitochondrial PPR protein, although despite their similarity, they may not have the same function [ (PUBMED:18729827) (PUBMED:23635806) ]. PTCD2 has a role in mitochondrial RNA metabolism and downstream effects on mitochondrial translation [ (PUBMED:22051507) (PUBMED:22777840) ]. PTCD2 has been identified as a target for autoantibodies in neurodegenerative disease and is used as a biomarker for Alzheimer disease [ (PUBMED:21826230) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MRP-S27